Phosl lectin
WebOct 28, 2024 · (B) Pholiota squarrosa lectin (PhoSL) binding assay for the specific detection of α1,6-linked fucose. ( C ) Oriole stained SDS-PAGE gel with 200 ng PNGase F treated omega-1 to assess the presence ... WebJul 6, 2024 · A new and innovative player in the field of Glyco-Immuno-Oncology, Phost’in Therapeutics develops a class of highly potent anti-cancer NCEs (new chemical entities) …
Phosl lectin
Did you know?
WebJan 30, 2016 · Fucosylation levels of AGP using AAL and PhoSL lectins. Fucosylation levels of AGP were analysed with an enzyme-linked lectin assay (ELLA) using A. aurantia lectin (AAL) which recognizes fucoses α1-2, α1-3 or α1-6-linked [7] and with P. squarrosa lectin (PhoSL) which recognizes only α1-6-linked fucose [24]. Both assays were optimized with ... Web开馆时间:周一至周日7:00-22:30 周五 7:00-12:00; 我的图书馆
WebMar 8, 2024 · The mini fungal lectin PhoSL was recombinantly produced and characterized. Despite a length of only 40 amino acids, PhoSL exclusively recognizes N-glycans with α1,6-linked fucose. Core fucosylation influences the intrinsic properties and bioactivities of mammalian N-glycoproteins and its level is linked to various cancers. WebOct 29, 2015 · We earlier reported the purification of a mitogenic lectin from human pathogenic fungus Cephalosporium curvulum (CSL) that has complex sugar specificity when analysed by hapten inhibition assay. In the present study, we report the fine sugar specificity of CSL as determined by glycan array analysis.
Webfor PC detection (PhoSL-HP ELISA method 1) The lectin-antibody ELISA for fucosylated haptoglobin (PhoSL-HP) was performed as described previously [11]. Briefly, a 96-well ELISA plate was coated with the Fab frag-ment of anti-human HP IgG (Dako, Carpinteria, CA, USA), because IgG has fucosylated oligosaccharides in its Fc por- WebSep 28, 2024 · To achieve the cure, new anti-HBV agents are needed. Here we found that Pholiota squarrosa lectin (PhoSL), a lectin that specifically binds core-fucose, inhibited …
WebPhoSL-hIgG1 is a lectin fused to human IgG constant region and specifically binds to α1-6 fucosylated N-glycans only and not other types of fucosylated oligosaccharides, such as α1-2-, α1-3-, and α1-4-fucosylated glycans. ... and afucosylated CHO cells stained with the PhoSL-hIgG1 (right). Anti-hIg PE was used as secondary Ab. Price is $200 ...
http://www.phosal.com/products.html mwu16 multiple flash writerWebSep 14, 2024 · Biotinylated Pholiota Squarrosa lectin (PhoSL), which specifically recognizes core fucosylated N-glycans, was a generous gift from Dr. Yuka Kobayashi (J-oil Mills, Tokyo, Japan). Alexa Fluor® 647 ... how to overcome shopping addictionWebTo complement the lectin profiling provided by the CFG array, we used AAL, LCA and PhoSL to perform lectin blots of protein extracts from eight CRC cell lines (HT29, Caco-2, SW480, SW620, DLD-1, HCT116, COLO205 adherent growth fraction and COLO205 suspension growth fraction). This set of CRC lines covers a broad range of CRC histopathological ... how to overcome sin in your lifeWebAug 25, 2024 · Here, we observed that the S proteins of the ancestral (Wuhan) and Omicron strains bind with Pholiota squarrosa lectin (PhoSL), a 40-amino-acid chemically synthesised peptide specific to core-fucosylated N-glycans. The affinities were at a low nanomolar level, which were ~ 1000-fold stronger than those between PhoSL and the core-fucosylated N ... how to overcome shyness作文WebOct 5, 2012 · The purified lectin was designated as PhoSL ( P. squarrosa lectin). SDS-PAGE, MALDI-TOF mass spectrometry, and N-terminal amino acid sequencing indicate that PhoSL has a molecular mass of 4.5 kDa and consists of 40 amino acids (NH 2 -APVPVTKLVCDGDTYKCTAYLDFGDGRWVAQWDTNVFHTG-OH). Isoelectric focusing of … how to overcome shyness in an interviewWebPhoSL, described as one of the most specific lectins for CF, mainly recognized structural variants of the α (1,6)fucosylated trimannosylchitobiose core. However, although the CF … how to overcome sibling rivalry in adulthoodWebOct 5, 2012 · The purified lectin was designated as PhoSL ( P. squarrosa lectin). SDS-PAGE, MALDI-TOF mass spectrometry, and N-terminal amino acid sequencing indicate that PhoSL has a molecular mass of 4.5 kDa … how to overcome silo mentality